Category Archives: DEFAULT

Time - Ash Ra Tempel & Timothy Leary* - Schwingungen / Seven Up

2 Oct

8 Replies to “ Time - Ash Ra Tempel & Timothy Leary* - Schwingungen / Seven Up

  1. Dec 09,  · And of course, it wouldn't be ASH RA TEMPEL without guitarist Manuel Göttsching, plus bassist Hartmut Enke is still here. This album features none other than Timothy Leary, the famous LSD guru! He was in exile in Switzerland, and in fact, ASH RA TEMPEL had to record this album in Switzerland because Leary would have been arrested if he ended.
  2. Aug 19,  · Ash Ra Tempel is one of the biggest names in the krautrock history and this third album of theirs was made together with Timothy Leary. Now one might assume that Seven Up would contain some of the most trippy and druggy music of all time but that's really not the case here/5(26).
  3. Ash Ra Tempel + Timothy Leary - Seven Up () Ash Ra Tempel + Timothy Leary - Seven Up () [Re] One of the most formidable of the German Krautrock groups, ASH RA TEMPEL were a powerful force led by guitarist Manuel GÖTTSCHING, and also included former TANGERINE DREAM drummer Klaus SCHULZE at various points.
  4. Timothy Leary* & Ash Ra Tempel ‎– Seven Up Label: Die Kosmischen Kuriere ‎– KK , Ohr ‎– KK , Die Kosmischen Kuriere ‎– KK , Ohr ‎– KK /5(61).
  5. The Ash Ra Tempel Experience album was released in September , and we've been fascinated by this gem since we got our hands on it. Not only does the album document a live performance of classic Ash Ra Tempel material performed by the renowned Ash Ra Tempel .
  6. Seven Up is the third studio album by German krautrock band Ash Ra Tempel and their only album recorded in collaboration with American psychologist/drug advocate Timothy psychedelic.whisperseekershagrelmalamuro.infoinfo was first Genre: Krautrock, psychedelic rock, space rock.
  7. Apr 02,  · Discover releases, reviews, credits, songs, and more about Timothy Leary* & Ash Ra Tempel - Seven Up at Discogs. Complete your Timothy Leary* & Ash Ra Tempel collection/5().
  8. Dec 27,  · The long track Time, which covered the whole of the second side of the original album, returns to the classic Ash Ra Tempel 'kosmische' sound, reprising the seminal chord-sequence first heard on Schwingungen, but with the Timothy Leary voiceover.4/4(6).

Leave a Reply

Your email address will not be published. Required fields are marked *